ARG58136

anti-F2R / PAR1 antibody

anti-F2R / PAR1 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes F2R / PAR1
Tested Reactivity Hu
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name F2R / PAR1
Antigen Species Human
Immunogen Synthetic peptide of Human F2R / PAR1. (RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK)
Conjugation Un-conjugated
Alternate Names CF2R; TR; Thrombin receptor; Proteinase-activated receptor 1; PAR1; Coagulation factor II receptor; PAR-1; HTR

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Boil tissue section in 10mM Citrate buffer (pH 6.0) for 20 min followed by cooling at RT.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer PBS, 0.025% Sodium azide and 2.5% BSA.
Preservative 0.025% Sodium azide
Stabilizer 2.5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2149 Human F2R

Swiss-port # P25116 Human Proteinase-activated receptor 1

Gene Symbol F2R
Gene Full Name coagulation factor II (thrombin) receptor
Background Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Function High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development. [UniProt]
Cellular Localization Cytoplasmic. [UniProt]
Calculated MW 47 kDa
PTM A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.

Phosphorylated in the C-terminal tail; probably mediating desensitization prior to the uncoupling and internalization of the receptor. [UniProt]