ARG58575
anti-FABP5 antibody
anti-FABP5 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes FABP5 |
---|---|
Tested Reactivity | Ms, Rat |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | FABP5 |
Antigen Species | Mouse |
Immunogen | Synthetic peptide corresponding to a sequence of Mouse FABP5. (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD). |
Conjugation | Un-conjugated |
Alternate Names | PA-FABP; Epidermal-type fatty acid-binding protein; KFABP; EFABP; E-FABP; Psoriasis-associated fatty acid-binding protein homolog; Fatty acid-binding protein, epidermal; Fatty acid-binding protein 5; PAFABP |
Application Instructions
Application Suggestion |
|
||||||
---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Purified. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # P55053 Rat Fatty acid-binding protein, epidermal Swiss-port # Q05816 Mouse Fatty acid-binding protein, epidermal |
---|---|
Gene Symbol | FABP5 |
Gene Full Name | fatty acid binding protein 5 (psoriasis-associated) |
Background | This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011] |
Function | High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. [UniProt] |
Cellular Localization | Cytoplasm. [UniProt] |
Calculated MW | 15 kDa |