ARG58575

anti-FABP5 antibody

anti-FABP5 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes FABP5
Tested Reactivity Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FABP5
Antigen Species Mouse
Immunogen Synthetic peptide corresponding to a sequence of Mouse FABP5. (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
Conjugation Un-conjugated
Alternate Names PA-FABP; Epidermal-type fatty acid-binding protein; KFABP; EFABP; E-FABP; Psoriasis-associated fatty acid-binding protein homolog; Fatty acid-binding protein, epidermal; Fatty acid-binding protein 5; PAFABP

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Purified.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 140868 Rat FABP5

GeneID: 16592 Mouse FABP5

Swiss-port # P55053 Rat Fatty acid-binding protein, epidermal

Swiss-port # Q05816 Mouse Fatty acid-binding protein, epidermal

Gene Symbol FABP5
Gene Full Name fatty acid binding protein 5 (psoriasis-associated)
Background This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
Function High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. [UniProt]
Cellular Localization Cytoplasm. [UniProt]
Calculated MW 15 kDa