ARG58616
anti-FECH antibody
anti-FECH antibody for ICC/IF,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes FECH |
|---|---|
| Tested Reactivity | Hu, Ms |
| Predict Reactivity | Cow, Rat, Dog, Gpig, Hrs, Rb, Yeast, Zfsh |
| Tested Application | ICC/IF, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | FECH |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human FECH. (within the following sequence: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM) |
| Conjugation | Un-conjugated |
| Alternate Names | EPP; EC 4.99.1.1; Ferrochelatase, mitochondrial; FCE; Protoheme ferro-lyase; Heme synthase |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | Jurkat |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | FECH |
| Gene Full Name | ferrochelatase |
| Background | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.[provided by RefSeq, May 2010] |
| Function | Catalyzes the ferrous insertion into protoporphyrin IX. [UniProt] |
| Calculated MW | 48 kDa |
