ARG58574
anti-FGB / Fibrinogen beta chain antibody
anti-FGB / Fibrinogen beta chain antibody for Flow cytometry,Western blot and Human,Mouse,Rat
Publication1
Overview
Product Description | Rabbit Polyclonal antibody recognizes FGB / Fibrinogen beta chain |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | FACS, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | FGB / Fibrinogen beta chain |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 193-225 of Human FGB / Fibrinogen beta chain. (TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT) |
Conjugation | Un-conjugated |
Alternate Names | Fibrinogen beta chain; HEL-S-78p |
Application Instructions
Application Suggestion |
|
||||||
---|---|---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | FGB |
Gene Full Name | fibrinogen beta chain |
Background | The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014] |
Function | Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. [UniProt] |
Cellular Localization | Secreted. [UniProt] |
Calculated MW | 56 kDa |
PTM | Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers. [UniProt] |