ARG58709

anti-FLT3 Ligand antibody

anti-FLT3 Ligand antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes FLT3 Ligand
Tested Reactivity Hu, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FLT3 Ligand
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 79-110 of Human Flt3 Ligand (AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK).
Conjugation Un-conjugated
Alternate Names FLT3L; SL cytokine; Fms-related tyrosine kinase 3 ligand; Flt3L; Flt3 ligand; FL

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2323 Human FLT3LG

Swiss-port # P49771 Human Fms-related tyrosine kinase 3 ligand

Gene Symbol FLT3LG
Gene Full Name fms-related tyrosine kinase 3 ligand
Background Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]
Function Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. [UniProt]
Cellular Localization Isoform 1: Cell membrane; Single-pass type I membrane protein. [UniProt]
Calculated MW 26 kDa