ARG58711

anti-FMO3 antibody

anti-FMO3 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes FMO3
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FMO3
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 404-433 of Human FMO3 (DMMNDINEKMEKKRKWFGKSETIQTDYIVY).
Conjugation Un-conjugated
Alternate Names Hepatic flavin-containing monooxygenase 3; FMO form 2; FMOII; TMAU; FMO II; dJ127D3.1; Dimethylaniline oxidase 3; FMO 3; EC 1.14.13.148; Trimethylamine monooxygenase; EC 1.14.13.8; Dimethylaniline monooxygenase [N-oxide-forming] 3

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 14262 Mouse FMO3

GeneID: 2328 Human FMO3

GeneID: 84493 Rat FMO3

Gene Symbol FMO3
Gene Full Name flavin containing monooxygenase 3
Background Flavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-,sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pesticides, and other foreign compounds. The human FMO gene family is composed of 5 genes and multiple pseudogenes. FMO members have distinct developmental- and tissue-specific expression patterns. The expression of this FMO3 gene, the major FMO expressed in adult liver, can vary up to 20-fold between individuals. This inter-individual variation in FMO3 expression levels is likely to have significant effects on the rate at which xenobiotics are metabolised and, therefore, is of considerable interest to the pharmaceutical industry. This transmembrane protein localizes to the endoplasmic reticulum of many tissues. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. Mutations in this gene cause the disorder trimethylaminuria (TMAu) which is characterized by the accumulation and excretion of unmetabolized trimethylamine and a distinctive body odor. In healthy individuals, trimethylamine is primarily converted to the non odorous trimethylamine N-oxide.[provided by RefSeq, Aug 2009]
Function Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds. [UniProt]
Cellular Localization Microsome membrane. Endoplasmic reticulum membrane. [UniProt]
Calculated MW 60 kDa

Images (1) Click the Picture to Zoom In

  • ARG58711 anti-FMO3 antibody WB image

    Western blot: 50 µg of Rat liver, 50 µg of Mouse liver and 40 µg of SMMC whole cell lysate stained with ARG58711 anti-FMO3 antibody at 0.5 µg/ml dilution.