ARG58756
anti-Fibromodulin antibody
anti-Fibromodulin antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections,IHC-Frozen sections,ICC/IF and Human,Horse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Fibromodulin |
|---|---|
| Tested Reactivity | Hu, Hrs |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Rb |
| Tested Application | ICC/IF, IHC-Fr, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Fibromodulin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human Fibromodulin. (within the following sequence: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER) |
| Conjugation | Un-conjugated |
| Alternate Names | Collagen-binding 59 kDa protein; SLRR2E; Fibromodulin; Keratan sulfate proteoglycan fibromodulin; KSPG fibromodulin; FM |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | FMOD |
| Gene Full Name | fibromodulin |
| Background | Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
| Function | Affects the rate of fibrils formation. May have a primary role in collagen fibrillogenesis (By similarity). [UniProt] |
| Calculated MW | 43 kDa |
| PTM | Binds keratan sulfate chains. [UniProt] |
