ARG56858

anti-Filamin C antibody

anti-Filamin C antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes Filamin C
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Filamin C
Antigen Species Human
Immunogen Synthetic peptide around the N-terminus of Human Filamin C. (VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP)
Conjugation Un-conjugated
Alternate Names ABP-280; FLNc; FLN2; Filamin-C; Gamma-filamin; ABP-280-like protein; ABPL; MPD4; Actin-binding-like protein; FLN-C; ABP280A; Filamin-2; MFM5; ABPA; ABP-L

Application Instructions

Application Suggestion
Tested Application Dilution
WB1.0 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2 whole cell

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2318 Human FLNC

Swiss-port # Q14315 Human Filamin-C

Gene Symbol FLNC
Gene Full Name filamin C, gamma
Background This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Function Muscle-specific filamin, which plays a central role in muscle cells, probably by functioning as a large actin-cross-linking protein. May be involved in reorganizing the actin cytoskeleton in response to signaling events, and may also display structural functions at the Z lines in muscle cells. Critical for normal myogenesis and for maintaining the structural integrity of the muscle fibers. [UniProt]
Calculated MW 291 kDa
PTM Ubiquitinated by FBXL22, leading to proteasomal degradation.