ARG41643

anti-GATA2 antibody

anti-GATA2 antibody for ChIP,Western blot and Human,Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes GATA2
Tested Reactivity Hu, Ms
Predict Reactivity Cow, Rat, Dog, Gpig, Hrs, Rb
Tested Application ChIP, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GATA2
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human GATA2. (within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA)
Conjugation Un-conjugated
Alternate Names DCML; GATA-binding protein 2; NFE1B; IMD21; Endothelial transcription factor GATA-2; MONOMAC

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Rabbit: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
ChIPAssay-dependent
WB1 - 2 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control K562
Observed Size ~ 50 kDa

Properties

Form Liquid
Purification Purification with Protein A.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 14461 Mouse GATA2

GeneID: 2624 Human GATA2

Swiss-port # O09100 Mouse Endothelial transcription factor GATA-2

Swiss-port # P23769 Human Endothelial transcription factor GATA-2

Gene Symbol GATA2
Gene Full Name GATA binding protein 2
Background This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Function Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 51 kDa