ARG59644
anti-GIF / Gastric intrinsic factor antibody
anti-GIF / Gastric intrinsic factor antibody for Western blot and Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GIF / Gastric intrinsic factor |
|---|---|
| Tested Reactivity | Ms |
| Predict Reactivity | Hu, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GIF / Gastric intrinsic factor |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide around the C-terminal region of Mouse GIF. (within the following region: LIVSSINNIAENVNHKTYWEFLSGKTPLDEGVAYYIPFNHEHITANFTQY) |
| Conjugation | Un-conjugated |
| Alternate Names | IF; GIF; INF; IFMH; TCN3 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CBLIF |
| Gene Full Name | cobalamin binding intrinsic factor |
| Background | This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. [provided by RefSeq, Jul 2008] |
| Function | Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis. [UniProt] |
| Cellular Localization | Extracellular region or secreted. [UniProt] |
| Calculated MW | 45 kDa |
