ARG58825
anti-GJA3 / Connexin 46 antibody
anti-GJA3 / Connexin 46 antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GJA3 / Connexin 46 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GJA3 / Connexin 46 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 89-118 of Human GJA3 (TLIYLGHVLHIVRMEEKKKEREEEEQLKRE). |
| Conjugation | Un-conjugated |
| Alternate Names | Cx46; CX46; CZP3; CTRCT14; Gap junction alpha-3 protein; Connexin-46 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | GJA3 |
| Gene Full Name | gap junction protein, alpha 3, 46kDa |
| Background | The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010] |
| Function | One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [UniProt] |
| Cellular Localization | Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. [UniProt] |
| Calculated MW | 47 kDa |
