ARG58934

anti-GNAZ antibody

anti-GNAZ antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes GNAZ
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GNAZ
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human GNAZ. (within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT)
Conjugation Un-conjugated
Alternate Names Guanine nucleotide-binding protein G(z) subunit alpha; G(x) alpha chain; Gz-alpha

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2781 Human GNAZ

Swiss-port # P19086 Human Guanine nucleotide-binding protein G(z) subunit alpha

Gene Symbol GNAZ
Gene Full Name guanine nucleotide binding protein (G protein), alpha z polypeptide
Background The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids. [provided by RefSeq, Jul 2008]
Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. [UniProt]
Cellular Localization Membrane; Lipid-anchor. [UniProt]
Calculated MW 41 kDa