ARG58786
anti-Galactosidase alpha antibody
anti-Galactosidase alpha antibody for Western blot and Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Galactosidase alpha |
|---|---|
| Tested Reactivity | Ms |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Galactosidase alpha |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide corresponding to aa. 218-275 of Mouse Galactosidase alpha (DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA). |
| Conjugation | Un-conjugated |
| Alternate Names | Alpha-galactosidase A; Melibiase; Alpha-D-galactosidase A; Alpha-D-galactoside galactohydrolase; EC 3.2.1.22; Agalsidase; GALA |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Gene Symbol | GLA |
|---|---|
| Gene Full Name | galactosidase, alpha |
| Background | This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. [provided by RefSeq, Jul 2008] |
| Cellular Localization | Lysosome. [UniProt] |
| Calculated MW | 49 kDa |
