ARG40286

anti-HAS1 antibody

anti-HAS1 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes HAS1
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name HAS1
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human HAS1. (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
Conjugation Un-conjugated
Alternate Names EC 2.4.1.212; Hyaluronate synthase 1; HA synthase 1; Hyaluronic acid synthase 1; HuHAS1; HAS; Hyaluronan synthase 1

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 65 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 15116 Mouse HAS1

GeneID: 3036 Human HAS1

Swiss-port # Q61647 Mouse Hyaluronan synthase 1

Swiss-port # Q92839 Human Hyaluronan synthase 1

Gene Symbol HAS1
Gene Full Name hyaluronan synthase 1
Background Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA is synthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extruded through pore-like structures into the extracellular space. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serum concentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. In addition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes, and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction. Also able to catalyze the synthesis of chito-oligosaccharide depending on the substrate (By similarity). [UniProt]
Cellular Localization Membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 65 kDa