ARG58801
anti-HOXB1 antibody
anti-HOXB1 antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes HOXB1 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | HOXB1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 176-220 of Human HOXB1 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK). |
| Conjugation | Un-conjugated |
| Alternate Names | HOX2; HOX2I; HCFP3; Hox-2.9; Homeobox protein Hox-B1; Homeobox protein Hox-2I |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | HOXB1 |
| Gene Full Name | homeobox B1 |
| Background | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq, Jul 2008] |
| Function | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 32 kDa |
