ARG59756
anti-HSD3B2 antibody
anti-HSD3B2 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human,Monkey
Overview
| Product Description | Rabbit Polyclonal antibody recognizes HSD3B2 |
|---|---|
| Tested Reactivity | Hu, Mk |
| Predict Reactivity | Ms, Rat, Cow, Dog, Goat, Gpig, Hrs, Sheep |
| Tested Application | IHC-P, WB |
| Specificity | This antibody might cross-react to HSD3B1 protein based on sequence analysis (90%). |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | HSD3B2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human HSD3B2. (within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN) |
| Conjugation | Un-conjugated |
| Alternate Names | 3-beta-HSD adrenal and gonadal type; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; HSDB; EC 1.1.1.145; HSD3B; EC 5.3.3.1; 3-beta-HSD II; 5; Progesterone reductase; SDR11E2; Delta-5-3-ketosteroid isomerase; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 85%; Dog: 93%; Goat: 85%; Guinea pig: 79%; Horse: 93%; Mouse: 79%; Rat: 86%; Sheep: 85% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | 293T | ||||||
| Observed Size | ~ 42 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P26439 Human 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 Swiss-port # P27365 Monkey 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 |
|---|---|
| Gene Symbol | HSD3B2 |
| Gene Full Name | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 |
| Background | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009] |
| Function | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. [UniProt] |
| Cellular Localization | Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. [UniProt] |
| Calculated MW | 42 kDa |
