ARG59688
anti-HSPA2 antibody [4A4]
anti-HSPA2 antibody [4A4] for IHC-Formalin-fixed paraffin-embedded sections,Western blot,Flow cytometry,ICC/IF and Human,Rat,Mouse
Overview
| Product Description | Mouse Monoclonal antibody [4A4] recognizes HSPA2 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Mouse |
| Clonality | Monoclonal |
| Clone | 4A4 |
| Isotype | IgG1 |
| Target Name | HSPA2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 564-598 of Human HSPA2. (KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK) |
| Conjugation | Un-conjugated |
| Alternate Names | Heat shock 70 kDa protein 2; Heat shock-related 70 kDa protein 2; HSP70-2; HSP70-3 |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | HSPA2 |
| Gene Full Name | heat shock 70kDa protein 2 |
| Function | In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. [UniProt] |
| Cellular Localization | Cytoplasm, cytoskeleton, spindle. Note=Colocalizes with SHCBP1L at spindle during the meiosis process. [UniProt] |
| Calculated MW | 70 kDa |
