ARG58797

anti-IBSP / Bone Sialoprotein antibody

anti-IBSP / Bone Sialoprotein antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes IBSP / Bone Sialoprotein
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IBSP / Bone Sialoprotein
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).
Conjugation Un-conjugated
Alternate Names Integrin-binding sialoprotein; BSP II; BSP; SP-II; Bone sialoprotein 2; BSP-II; Bone sialoprotein II; Cell-binding sialoprotein; BNSP

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 15891 Mouse IBSP

GeneID: 3381 Human IBSP

Swiss-port # P21815 Human Bone sialoprotein 2

Swiss-port # Q61711 Mouse Bone sialoprotein 2

Gene Symbol IBSP
Gene Full Name integrin-binding sialoprotein
Background The protein encoded by this gene is a major structural protein of the bone matrix. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. [provided by RefSeq, Jul 2008]
Function Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 35 kDa
PTM N-glycosylated; glycans consist of sialylated and core-fucosylated bi-, tri- and tetraantennary chains.

O-glycosylated at eight sites; mucin-type glycans contain Gal, GlcNAc, GalNAc and terminal NeuAc.

Sulfated on either Tyr-313 or Tyr-314. [UniProt]