ARG42740

anti-IDH1 antibody

anti-IDH1 antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,IHC-Frozen sections,Immunocytochemistry,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes IDH1
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application FACS, ICC, IHC-Fr, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IDH1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 381-413 of Human IDH1. (KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK)
Conjugation Un-conjugated
Alternate Names IDPC; EC 1.1.1.42; Cytosolic NADP-isocitrate dehydrogenase; IDP; HEL-S-26; HEL-216; Isocitrate dehydrogenase [NADP] cytoplasmic; IDH; PICD; IDCD; NADP; Oxalosuccinate decarboxylase

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC1:200 - 1:1000
IHC-Fr1:200 - 1:1000
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size 47 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 15926 Mouse IDH1

GeneID: 24479 Rat IDH1

GeneID: 3417 Human IDH1

Gene Symbol IDH1
Gene Full Name isocitrate dehydrogenase 1 (NADP+), soluble
Background Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
Cellular Localization Cytoplasm. Peroxisome. [UniProt]
Highlight Related products:
Isocitrate Dehydrogenase antibodies; Isocitrate Dehydrogenase ELISA Kits; Anti-Rabbit IgG secondary antibodies;
Related news:
TCA intermediate fumarate promotes mitobiogenesis
Calculated MW 47 kDa
PTM Acetylation at Lys-374 dramatically reduces catalytic activity. [UniProt]