ARG10676

anti-IGFBP1 antibody

anti-IGFBP1 antibody for Western blot and Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes IGFBP1
Tested Reactivity Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IGFBP1
Antigen Species Mouse
Immunogen Synthetic peptide corresponding to the sequence at a.a 177-207 (REIADLKKWKEPCQRELYKVLERLAAAQQKA) around the C-terminus of mouse IGFBP1 protein.
Conjugation Un-conjugated
Alternate Names AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1; IGF-binding protein 1; IGFBP-1; Placental protein 12

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 μg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 1X PBS, 0.025% Sodium azide and 2.5% BSA
Preservative 0.025% Sodium azide
Stabilizer 2.5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 16006 Mouse IGFBP1

GeneID: 25685 Rat IGFBP1

Swiss-port # P21743 Rat Insulin-like growth factor-binding protein 1

Swiss-port # P47876 Mouse Insulin-like growth factor-binding protein 1

Gene Symbol Igfbp1
Gene Full Name Insulin Like Growth Factor Binding Protein 1
Background This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008]
Function GF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. [UniProt]
Calculated MW 28 kDa
PTM Phosphorylated; probably by casein kinase II. Phosphorylation alters the affinity of the protein for IGFs. In amniotic fluid, the unmodified protein is the most abundant form, while mono-, bi-, tri- and tetraphosphorylated forms are present in decreasing amounts. The phosphorylation state may influence the propensity to proteolysis.