ARG10675

anti-IGFBP3 antibody

anti-IGFBP3 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes IGFBP3
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IGFBP3
Antigen Species Human
Immunogen Synthetic peptide corresponding to the sequence at a.a 214-252 (RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR) around the C-terminus of human IGFBP3 protein.
Conjugation Un-conjugated
Alternate Names IBP3; BP-53; IGF-binding protein 3; IGFBP-3

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 2 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Boil tissue sections in 10 mM Citrate buffer (pH 6.0) for 20 min
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Rat heart, Rat brain, Rat liver, PC-12, U-87 MG, Mouse kidney, Mouse heart and Mouse brain
Observed Size ~ 40 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 1X PBS, 0.025% Sodium azide and 2.7% BSA
Preservative 0.027% Sodium azide
Stabilizer 2.7% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 16009 Mouse IGFBP3

GeneID: 24484 Rat IGFBP3

GeneID: 3486 Human IGFBP3

Gene Symbol IGFBP3
Gene Full Name Insulin Like Growth Factor Binding Protein 3
Background This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Calculated MW 32 kDa
PTM Phosphorylated by FAM20C in the extracellular medium.