ARG59246

anti-IRF9 antibody

anti-IRF9 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes IRF9
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IRF9
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human IRF9. (within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK)
Conjugation Un-conjugated
Alternate Names ISGF-3 gamma; Transcriptional regulator ISGF3 subunit gamma; ISGF3G; ISGF3; Interferon-stimulated gene factor 3 gamma; IRF-9; ISGF3 p48 subunit; p48; IFN-alpha-responsive transcription factor subunit; Interferon regulatory factor 9

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Application Suggestion
Tested Application Dilution
IHC-PAssay-dependent
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2
Observed Size ~ 40 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 10379 Human IRF9

Swiss-port # Q00978 Human Interferon regulatory factor 9

Gene Symbol IRF9
Gene Full Name interferon regulatory factor 9
Function Transcription factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. [UniProt]
Cellular Localization Cytoplasm. Nucleus. Note=Translocated into the nucleus upon activation by IFN-alpha/beta. [UniProt]
Calculated MW 44 kDa