ARG59333

anti-KChIP2 antibody

anti-KChIP2 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes KChIP2
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Chk
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name KChIP2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 78-112 of Human KChIP2. (DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR)
Conjugation Un-conjugated
Alternate Names Potassium channel-interacting protein 2; A-type potassium channel modulatory protein 2; Kv channel-interacting protein 2; Cardiac voltage-gated potassium channel modulatory subunit; KCHIP2; KChIP2

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 30819 Human KCNIP2

GeneID: 56817 Rat KCNIP2

GeneID: 80906 Mouse KCNIP2

Gene Symbol KCNIP2
Gene Full Name Kv channel interacting protein 2
Background This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008]
Function Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart (By similarity). [UniProt]
Cellular Localization Isoform 1: Cell membrane; Lipid-anchor. Note=Detected on lipid rafts (By similarity). Isoform 2: Cell membrane; Lipid-anchor. Isoform 6: Cell membrane; Lipid-anchor. [UniProt]
Calculated MW 31 kDa
PTM Palmitoylated. Palmitoylation enhances association with the plasma membrane. [UniProt]