ARG59272
anti-KDM5B / Jarid1B antibody
anti-KDM5B / Jarid1B antibody for Western blot,Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,ICC/IF and Human,Mouse,Rat,Monkey
Overview
| Product Description | Rabbit Polyclonal antibody recognizes KDM5B / Jarid1B |
|---|---|
| Tested Reactivity | Hu, Ms, Rat, Mk |
| Predict Reactivity | Bov, Dog, Hm, Hrs, Rb |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | KDM5B / Jarid1B |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 641-685 of Human KDM5B / Jarid1B. (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) |
| Conjugation | Un-conjugated |
| Alternate Names | PPP1R98; Histone demethylase JARID1B; PUT1; RBBP2H1A; Cancer/testis antigen 31; Jumonji/ARID domain-containing protein 1B; Retinoblastoma-binding protein 2 homolog 1; PLU-1; PLU1; RBP2-H1; CT31; EC 1.14.11.-; Lysine-specific demethylase 5B; JARID1B |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in EDTA buffer (pH 8.0). * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | KDM5B |
| Gene Full Name | lysine (K)-specific demethylase 5B |
| Background | This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants. [provided by RefSeq, Sep 2015] |
| Function | Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity). [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Highlight | Related products: KDM5B antibodies; Anti-Rabbit IgG secondary antibodies; Related news: Hypoxia-induced transcription, histone demethylases are involved |
| Calculated MW | 176 kDa |
