ARG59203
anti-LPAR6 / P2RY5 antibody
anti-LPAR6 / P2RY5 antibody for Flow cytometry,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes LPAR6 / P2RY5 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | LPAR6 / P2RY5 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human LPAR6 / P2RY5. (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK) |
| Conjugation | Un-conjugated |
| Alternate Names | LAH3; P2Y purinoceptor 5; Oleoyl-L-alpha-lysophosphatidic acid receptor; Purinergic receptor 5; Lysophosphatidic acid receptor 6; P2Y5; LPA receptor 6; ARWH1; RB intron encoded G-protein coupled receptor; HYPT8; LPA-6; P2RY5 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | LPAR6 |
| Gene Full Name | lysophosphatidic acid receptor 6 |
| Background | The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009] |
| Function | Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture. [UniProt] |
| Cellular Localization | Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 39 kDa |
