ARG59893
anti-LRIG3 antibody
anti-LRIG3 antibody for Western blot and Human,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes LRIG3 |
---|---|
Tested Reactivity | Hu, Rat |
Predict Reactivity | Bov, Hrs, Mk, Rb |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | LRIG3 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 428-465 of Human LRIG3. (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ) |
Conjugation | Un-conjugated |
Alternate Names | LIG-3; Leucine-rich repeats and immunoglobulin-like domains protein 3; LIG3 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Observed Size | ~ 120 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q6UXM1 Human Leucine-rich repeats and immunoglobulin-like domains protein 3 |
---|---|
Gene Symbol | LRIG3 |
Gene Full Name | leucine-rich repeats and immunoglobulin-like domains 3 |
Function | May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1 (By similarity). [UniProt] |
Cellular Localization | Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Note=Detected in cytoplasmic vesicles when coexpressed with ERBB4. [UniProt] |
Calculated MW | 123 kDa |