ARG43092
anti-MCUR1 antibody
anti-MCUR1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MCUR1 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MCUR1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human MCUR1. (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE) |
| Conjugation | Un-conjugated |
| Alternate Names | CCDC90A; C6orf79; Mitochondrial calcium uniporter regulator 1; Coiled-coil domain-containing protein 90A, mitochondrial |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 40 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q96AQ8 Human Mitochondrial calcium uniporter regulator 1 Swiss-port # Q9CXD6 Mouse Mitochondrial calcium uniporter regulator 1 |
|---|---|
| Gene Symbol | MCUR1 |
| Gene Full Name | mitochondrial calcium uniporter regulator 1 |
| Function | Key regulator of mitochondrial calcium uniporter (MCU) required for calcium entry into mitochondrion (PubMed:23178883, PubMed:26445506, PubMed:27184846, PubMed:26976564). Plays a direct role in uniporter-mediated calcium uptake via a direct interaction with MCU (PubMed:23178883). Probably involved in the assembly of the membrane components of the uniporter complex (uniplex) (PubMed:27184846). [UniProt] |
| Cellular Localization | Mitochondrion inner membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 40 kDa |
