ARG40422

anti-MMP17 / MT4-MMP antibody

anti-MMP17 / MT4-MMP antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes MMP17 / MT4-MMP
Tested Reactivity Hu
Predict Reactivity Cow, Hrs
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MMP17 / MT4-MMP
Antigen Species Human
Immunogen Synthetic peptide from Human MMP17 / MT4-MMP. (located within the following region: YPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVC)
Conjugation Un-conjugated
Alternate Names Membrane-type matrix metalloproteinase 4; MT-MMP 4; MT4-MMP; EC 3.4.24.-; MT4MMP; MTMMP4; MMP-17; Membrane-type-4 matrix metalloproteinase; Matrix metalloproteinase-17

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 79%; Horse: 93%
Application Suggestion
Tested Application Dilution
WB1 ug/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 4326 Human MMP17

Swiss-port # Q9ULZ9 Human Matrix metalloproteinase-17

Gene Symbol MMP17
Gene Full Name matrix metallopeptidase 17 (membrane-inserted)
Background Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene is considered a member of the membrane-type MMP (MT-MMP) subfamily. However, this protein is unique among the MT-MMP's in that it is a GPI-anchored protein rather than a transmembrane protein. The protein activates MMP-2 by cleavage. [provided by RefSeq, Jul 2008]
Function Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin. [UniProt]
Cellular Localization Isoform Long: Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side. Secreted, extracellular space, extracellular matrix. [UniProt]
Calculated MW 67 kDa
PTM The precursor is cleaved by a furin endopeptidase. [UniProt]