ARG43058
anti-MORC3 antibody
anti-MORC3 antibody for Flow cytometry,ICC/IF,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MORC3 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MORC3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human MORC3. (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD) |
| Conjugation | Un-conjugated |
| Alternate Names | ZCW5; Zinc finger CW-type coiled-coil domain protein 3; ZCWCC3; NXP2; MORC family CW-type zinc finger protein 3 |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q14149 Human MORC family CW-type zinc finger protein 3 |
|---|---|
| Gene Symbol | MORC3 |
| Gene Full Name | MORC family CW-type zinc finger 3 |
| Background | This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2016] |
| Function | Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233). [UniProt] |
| Cellular Localization | Nucleus, nucleoplasm. Nucleus matrix. Nucleus, PML body. Note=Also found in PML-independent nuclear bodies. Localization to nuclear bodies is ATP-dependent. [UniProt] |
| Calculated MW | 107 kDa |
| PTM | Sumoylation is involved in interaction with PML and localization to PML nuclear bodies. [UniProt] |
