ARG59030

anti-MPP1 antibody

anti-MPP1 antibody for Flow cytometry,ICC/IF,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes MPP1
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application FACS, ICC/IF, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MPP1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 409-450 of Human MPP1 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF).
Conjugation Un-conjugated
Alternate Names AAG12; PEMP; DXS552E; EMP55; Membrane protein, palmitoylated 1; p55; MRG1; 55 kDa erythrocyte membrane protein

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 17524 Mouse MPP1

GeneID: 4354 Human MPP1

Swiss-port # P70290 Mouse 55 kDa erythrocyte membrane protein

Swiss-port # Q00013 Human 55 kDa erythrocyte membrane protein

Gene Symbol MPP1
Gene Full Name membrane protein, palmitoylated 1, 55kDa
Background This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Function Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity (By similarity). [UniProt]
Cellular Localization Membrane; Lipid-anchor. Cell projection, stereocilium. Colocalizes with WHRN at stereocilium tip during hair cell development (By similarity). Colocalizes with MPP5 in the retina, at the outer limiting membrane (OLM). Colocalizes with WHRN in the retina, at the outer limiting membrane (OLM), outer plexifirm layer (OPL), basal bodies and at the connecting cilium (CC). Colocalizes with NF2 in non- myelin-forming Schwann cells. [UniProt]
Calculated MW 52 kDa
PTM Extensively palmitoylated by ZDHHC17, palmitoylation is essential for membrane organization and is crucial for proper erythrocytes morphology. [UniProt]