ARG42963
anti-MRP2 antibody
anti-MRP2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MRP2 |
|---|---|
| Tested Reactivity | Hu, Ms |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MRP2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human MRP2. (AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD) |
| Conjugation | Un-conjugated |
| Alternate Names | DJS; ATP-binding cassette sub-family C member 2; CMOAT; ABC30; cMRP; Canalicular multidrug resistance protein; MRP2; Canalicular multispecific organic anion transporter 1; Multidrug resistance-associated protein 2 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 210 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q8VI47 Mouse Canalicular multispecific organic anion transporter 1 Swiss-port # Q92887 Human Canalicular multispecific organic anion transporter 1 |
|---|---|
| Gene Symbol | ABCC2 |
| Gene Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 2 |
| Background | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008] |
| Function | Mediates hepatobiliary excretion of numerous organic anions and conjugated organic anions such as methotrexate, 17beta-estradiol 17-glucosiduronic acid and leukotriene C4 (PubMed:11500505). Also transports sulfated bile salt such as taurolithocholate sulfate (PubMed:16332456). May function as a cellular cisplatin transporter. [UniProt] |
| Cellular Localization | Apical cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 174 kDa |
