ARG10823

anti-MTF6 antibody

anti-MTF6 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

nuts_pic
1

Overview

Product Description Rabbit Polyclonal antibody recognizes MTF6
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Goat, Gpig, Hrs, Rb, Sheep, Zfsh
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MTF6
Antigen Species Human
Immunogen Synthetic peptide around the N-terminus of Human MYF6.
(PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA)
Conjugation Un-conjugated
Alternate Names Muscle-specific regulatory factor 4; Myf-6; bHLHc4; myf-6; Class C basic helix-loop-helix protein 4; MRF4; Myogenic factor 6; CNM3

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P4 - 8 µg/ml
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Fetal heart.

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 4618 Human MYF6

Swiss-port # P23409 Human Myogenic factor 6

Gene Symbol MYF6
Gene Full Name myogenic factor 6 (herculin)
Background The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). [provided by RefSeq, May 2010]
Function Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein. [UniProt]
Calculated MW 27 kDa

Customer's Feedback

nuts_pic      Excellent

Review for anti-MTF6 antibody

Application:WB

Sample:293T

Sample Loading Amount:20 µg

Primary Antibody Dilution Factor:1:500

Primary Antibody Incubation Time:overnight

Primary Antibody Incubation Temperature:4 ºC