ARG41678

anti-MUC2 / Mucin 2 antibody

anti-MUC2 / Mucin 2 antibody for IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes MUC2 / Mucin 2
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MUC2 / Mucin 2
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human MUC2 / Mucin 2. (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD)
Conjugation Un-conjugated
Alternate Names MUC-2; MLP; Intestinal mucin-2; SMUC; Mucin-2

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 4583 Human MUC2

Swiss-port # Q02817 Human Mucin-2

Gene Symbol MUC2
Gene Full Name mucin 2, oligomeric mucus/gel-forming
Background This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2008]
Function Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. [UniProt]
Calculated MW 540 kDa
PTM O-glycosylated.

May undergo proteolytic cleavage in the outer mucus layer of the colon, contributing to the expanded volume and loose nature of this layer which allows for bacterial colonization in contrast to the inner mucus layer which is dense and devoid of bacteria.

At low pH of 6 and under, undergoes autocatalytic cleavage in vitro in the N-terminal region of the fourth VWD domain. It is likely that this also occurs in vivo and is triggered by the low pH of the late secretory pathway. [UniProt]