ARG59437

anti-NAA15 / NARG1 antibody

anti-NAA15 / NARG1 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes NAA15 / NARG1
Tested Reactivity Hu, Ms
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name NAA15 / NARG1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 244-287 of Human NAA15 / NARG1. (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY)
Conjugation Un-conjugated
Alternate Names Protein tubedown-1; N-terminal acetyltransferase; Tbdn100; NARG1; TBDN; TBDN100; NATH; N-alpha-acetyltransferase 15, NatA auxiliary subunit; NMDA receptor-regulated protein 1; Ga19; Gastric cancer antigen Ga19; NAT1P

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 80155 Human NAA15

Swiss-port # Q9BXJ9 Human N-alpha-acetyltransferase 15, NatA auxiliary subunit

Gene Symbol NAA15
Gene Full Name N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Background This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeq, Jul 2008]
Function Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. [UniProt]
Cellular Localization Cytoplasm. Nucleus. Note=Mainly cytoplasmic, nuclear in some cases. Present in the free cytosolic and cytoskeleton-bound polysomes, but not in the membrane-bound polysomes. [UniProt]
Calculated MW 101 kDa
PTM Cleaved by caspases during apoptosis, resulting in a stable 35 kDa fragment. [UniProt]