ARG59010
anti-NEDD8 antibody
anti-NEDD8 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes NEDD8 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | FACS, ICC/IF, IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | NEDD8 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 20-60 of Human NEDD8 (TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK). |
Conjugation | Un-conjugated |
Alternate Names | NEDD8; Ubiquitin-like protein Nedd8; Neddylin; NEDD-8; Neural precursor cell expressed developmentally down-regulated protein 8 |
Application Instructions
Application Suggestion |
|
||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | NEDD8 |
Gene Full Name | neural precursor cell expressed, developmentally down-regulated 8 |
Function | Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins. [UniProt] |
Cellular Localization | Nucleus. Mainly nuclear. [UniProt] |
Calculated MW | 9 kDa |
PTM | Cleavage of precursor form by UCHL3 or SENP8 is necessary for function. [UniProt] |