ARG40280

anti-NQO1 antibody

anti-NQO1 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes NQO1
Tested Reactivity Hu, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name NQO1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 242-274 of Human NQO1. (EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK)
Conjugation Un-conjugated
Alternate Names DTD; QR1; DHQU; DIA4; NMOR1; NMORI; NAD(P)H dehydrogenase [quinone] 1; EC 1.6.5.2; Azoreductase; DT-diaphorase; DTD; Menadione reductase; NAD(P)H:quinone oxidoreductase 1; Phylloquinone reductase; Quinone reductase 1; QR1

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 30 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 1728 Human NQO1

GeneID: 24314 Rat NQO1

Swiss-port # P05982 Rat NAD(P)H dehydrogenase [quinone] 1

Swiss-port # P15559 Human NAD(P)H dehydrogenase [quinone] 1

Gene Symbol NQO1
Gene Full Name NAD(P)H dehydrogenase, quinone 1
Background This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Function The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. [UniProt]
Cellular Localization Cytoplasm. [UniProt]
Highlight Related products:
NQO1 antibodies; NQO1 Duos / Panels; Anti-Rabbit IgG secondary antibodies;
Related news:
Keap1-Nrf2-ARE antibody panel is launched
Calculated MW 31 kDa