ARG59039
anti-NR3C2 / Mineralocorticoid Receptor antibody
anti-NR3C2 / Mineralocorticoid Receptor antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NR3C2 / Mineralocorticoid Receptor |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Chk |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NR3C2 / Mineralocorticoid Receptor |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 950-984 of Human NR3C2 (HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK). |
| Conjugation | Un-conjugated |
| Alternate Names | NR3C2VIT; MR; MLR; Nuclear receptor subfamily 3 group C member 2; Mineralocorticoid receptor; MCR |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NR3C2 |
| Gene Full Name | nuclear receptor subfamily 3, group C, member 2 |
| Background | This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
| Function | Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein. Cytoplasmic and nuclear in the absence of ligand; nuclear after ligand-binding. When bound to HSD11B2, it is found associated with the endoplasmic reticulum membrane. [UniProt] |
| Calculated MW | 107 kDa |
| PTM | Phosphorylated. [UniProt] |
