ARG40517

anti-OAS1 antibody

anti-OAS1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes OAS1
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Hrs, Pig, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name OAS1
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human OAS1. (within the following region: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS)
Conjugation Un-conjugated
Alternate Names A; OIASI; p46/p42 OAS; E18/E16; 2-5'; OIAS; IFI-4; EC 2.7.7.84; 2-5A synthase 1; 2'-5'-oligoadenylate synthase 1

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 86%; Dog: 79%; Horse: 86%; Mouse: 86%; Pig: 79%; Rabbit: 79%; Rat: 79%
Application Suggestion
Tested Application Dilution
IHC-P5 µg/ml
WB0.2 - 1 ug/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size 39 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 4938 Human OAS1

Swiss-port # P00973 Human 2'-5'-oligoadenylate synthase 1

Gene Symbol OAS1
Gene Full Name 2'-5'-oligoadenylate synthetase 1, 40/46kDa
Background This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Function Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L. [UniProt]
Cellular Localization Cytoplasm. Mitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Secreted. Note=Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions. [UniProt]
Calculated MW 46 kDa

Images (2) Click the Picture to Zoom In

  • ARG40517 anti-OAS1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human small intestine section. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40517 anti-OAS1 antibody at 5 ug/ml, overnight at 4°C.

  • ARG40517 anti-OAS1 antibody WB image

    Western blot: Human stomach lysate stained with ARG40517 anti-OAS1 antibody at 0.2 - 1 ug/ml dilution.