ARG58840

anti-OPN / Osteopontin antibody

anti-OPN / Osteopontin antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes OPN / Osteopontin
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name OPN / Osteopontin
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 281-314 of Human Osteopontin (HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN).
Conjugation Un-conjugated
Alternate Names BSPI; ETA-1; Uropontin; Osteopontin; Nephropontin; SPP-1; Bone sialoprotein 1; BNSP; Urinary stone protein; OPN; Secreted phosphoprotein 1

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 20750 Mouse SPP1

GeneID: 6696 Human SPP1

Swiss-port # P10451 Human Osteopontin

Swiss-port # P10923 Mouse Osteopontin

Gene Symbol SPP1
Gene Full Name secreted phosphoprotein 1
Background The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Function Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.

Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity. [UniProt]
Cellular Localization Secreted. [UniProt]
Highlight Related products:
OPN antibodies; OPN ELISA Kits; Anti-Rabbit IgG secondary antibodies;
Related news:
The role of HDGF in tumor angiogenesis
Calculated MW 35 kDa
PTM Extensively phosphorylated by FAM20C in the extracellular medium at multiple sites within the S-x-E/pS motif.

N- and O-glycosylated. Isoform 5 is GalNAc O-glycosylated at Thr-59 or Ser-62. [UniProt]