ARG43087

anti-PAK5 / PAK7 antibody

anti-PAK5 / PAK7 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes PAK5 / PAK7
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name PAK5 / PAK7
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 26-55 of Human PAK5. (DPQEQKFTGLPQQWHSLLADTANRPKPMVD)
Conjugation Un-conjugated
Alternate Names EC 2.7.11.1; Serine/threonine-protein kinase PAK 7; PAK5; p21-activated kinase 7; p21-activated kinase 5; PAK-7; PAK-5

Application Instructions

Application Suggestion
Tested Application Dilution
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Rat brain, Mouse brain and U87
Observed Size ~ 80 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 241656 Mouse PAK7

GeneID: 311450 Rat PAK7

GeneID: 57144 Human PAK7

Gene Symbol PAK7
Gene Full Name p21 protein (Cdc42/Rac)-activated kinase 7
Background The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. This kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. This kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Function Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions. [UniProt]
Cellular Localization Mitochondrion. Cytoplasm. Nucleus. Note=Shuttles between the nucleus and the mitochondria, and mitochondrial localization is essential for the role in cell survival. [UniProt]
Calculated MW 81 kDa
PTM Autophosphorylated when activated by CDC42/p21. [UniProt]