ARG43089
anti-PCDH15 antibody
anti-PCDH15 antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes PCDH15 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | PCDH15 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human PCDH15. (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ) |
| Conjugation | Un-conjugated |
| Alternate Names | DFNB23; Protocadherin-15; USH1F; CDHR15 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | PCDH15 |
| Gene Full Name | protocadherin-related 15 |
| Background | This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur. [provided by RefSeq, Dec 2008] |
| Function | Calcium-dependent cell-adhesion protein. Essential for maintenance of normal retinal and cochlear function. [UniProt] |
| Cellular Localization | Cell membrane; Single-pass type I membrane protein. Note=Efficient localization to the plasma membrane requires the presence of LHFPL5. Isoform 3: Secreted. [UniProt] |
| Calculated MW | 216 kDa |
