ARG59302

anti-POLI / DNA Polymerase Iota antibody

anti-POLI / DNA Polymerase Iota antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes POLI / DNA Polymerase Iota
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name POLI / DNA Polymerase Iota
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human POLI / DNA Polymerase Iota. (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK)
Conjugation Un-conjugated
Alternate Names RAD30B; Eta2; RAD3OB; DNA polymerase iota; EC 2.7.7.7; RAD30 homolog B

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 11201 Human POLI

GeneID: 26447 Mouse POLI

Swiss-port # Q6R3M4 Mouse DNA polymerase iota

Swiss-port # Q9UNA4 Human DNA polymerase iota

Gene Symbol POLI
Gene Full Name polymerase (DNA directed) iota
Function Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity. [UniProt]
Cellular Localization Nucleus. Note=Accumulates at replication forks after DNA damage. [UniProt]
Calculated MW 83 kDa