ARG59245
anti-PREB antibody
anti-PREB antibody for Western blot and Mouse
Overview
Product Description | Rabbit Polyclonal antibody recognizes PREB |
---|---|
Tested Reactivity | Ms |
Predict Reactivity | Hu, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Zfsh |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | PREB |
Antigen Species | Mouse |
Immunogen | Synthetic peptide around the N-terminal region of Mouse PREB. (within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL) |
Conjugation | Un-conjugated |
Alternate Names | Prolactin regulatory element-binding protein; SEC12; Mammalian guanine nucleotide exchange factor mSec12 |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% | ||||
---|---|---|---|---|---|
Application Suggestion |
|
||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
Observed Size | ~ 45 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q9WUQ2 Mouse Prolactin regulatory element-binding protein |
---|---|
Gene Symbol | PREB |
Gene Full Name | prolactin regulatory element binding |
Background | This gene encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p. This gene overlaps the abhydrolase domain containing 1 (ABHD1) gene on the opposite strand. [provided by RefSeq, Jul 2008] |
Function | Was first identified based on its probable role in the regulation of pituitary gene transcription. Binds to the prolactin gene (PRL) promoter and seems to activate transcription (By similarity). Guanine nucleotide exchange factor that activates SARA2. Required for the formation of COPII transport vesicles from the ER. [UniProt] |
Cellular Localization | Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus. Note=Concentrates at endoplasmic reticulum exit sites. [UniProt] |
Calculated MW | 45 kDa |