ARG59652
anti-PRMT2 antibody
anti-PRMT2 antibody for Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes PRMT2 |
|---|---|
| Tested Reactivity | Hu, Ms |
| Predict Reactivity | Cow, Rat, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | PRMT2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human PRMT2. (within the following region: ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL) |
| Conjugation | Un-conjugated |
| Alternate Names | EC 2.1.1.125; Histone-arginine N-methyltransferase PRMT2; HRMT1L1; Protein arginine N-methyltransferase 2; EC 2.1.1.- |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P55345 Human Protein arginine N-methyltransferase 2 |
|---|---|
| Gene Symbol | PRMT2 |
| Gene Full Name | protein arginine methyltransferase 2 |
| Function | Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation. [UniProt] |
| Cellular Localization | Isoform 1: Cytoplasm. Nucleus. Note=Translocates from the cytoplasm to the nucleus, after hormone exposure. Excluded from nucleolus. Isoform PRMT2Alpha: Nucleus. Note=Excluded from nucleolus. Isoform PRMT2Beta: Cytoplasm. Nucleus. Nucleus, nucleolus. Isoform PRMT2Gamma: Nucleus. Note=Excluded from nucleolus. Isoform PRMT2L2: Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. [UniProt] |
| Calculated MW | 49 kDa |
