ARG40846
anti-Properdin antibody
anti-Properdin antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot,Flow cytometry and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Properdin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Properdin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human Properdin. (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR) |
| Conjugation | Un-conjugated |
| Alternate Names | PFC; PFD; BFD; PROPERDIN; Complement factor P; Properdin |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CFP |
| Gene Full Name | complement factor properdin |
| Background | This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Feb 2009] |
| Function | A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 51 kDa |
