ARG59337

anti-RAB14 antibody

anti-RAB14 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes RAB14
Tested Reactivity Hu, Rat
Predict Reactivity Hm
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name RAB14
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 124-153 of Human RAB14. (NKADLEAQRDVTYEEAKQFAEENGLLFLEA)
Conjugation Un-conjugated
Alternate Names RAB-14; Ras-related protein Rab-14; FBP

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 51552 Human RAB14

GeneID: 94197 Rat RAB14

Swiss-port # P61106 Human Ras-related protein Rab-14

Swiss-port # P61107 Rat Ras-related protein Rab-14

Gene Symbol RAB14
Gene Full Name RAB14, member RAS oncogene family
Background RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009]
Function Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes (By similarity). Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion. [UniProt]
Cellular Localization Recycling endosome. Early endosome membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome. Note=Recruited to recycling endosomes by DENND6A (PubMed:22595670). Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211). [UniProt]
Calculated MW 24 kDa