ARG59336

anti-RAB18 antibody

anti-RAB18 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes RAB18
Tested Reactivity Hu, Rat
Predict Reactivity Bov
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name RAB18
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 156-192 of Human RAB18. (DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE)
Conjugation Un-conjugated
Alternate Names WARBM3; RAB18LI1; Ras-related protein Rab-18

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 22931 Human RAB18

GeneID: 307039 Rat RAB18

Swiss-port # Q5EB77 Rat Ras-related protein Rab-18

Swiss-port # Q9NP72 Human Ras-related protein Rab-18

Gene Symbol RAB18
Gene Full Name RAB18, member RAS oncogene family
Background The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]
Function Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration. [UniProt]
Cellular Localization Cell membrane; Lipid-anchor; Cytoplasmic side. [UniProt]
Calculated MW 23 kDa