ARG59336
anti-RAB18 antibody
anti-RAB18 antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes RAB18 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Predict Reactivity | Bov |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | RAB18 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 156-192 of Human RAB18. (DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE) |
| Conjugation | Un-conjugated |
| Alternate Names | WARBM3; RAB18LI1; Ras-related protein Rab-18 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | RAB18 |
| Gene Full Name | RAB18, member RAS oncogene family |
| Background | The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012] |
| Function | Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration. [UniProt] |
| Cellular Localization | Cell membrane; Lipid-anchor; Cytoplasmic side. [UniProt] |
| Calculated MW | 23 kDa |
