ARG59042

anti-RBBP4 / RbAp48 antibody

anti-RBBP4 / RbAp48 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot,Flow cytometry,ICC/IF,IHC-Frozen sections and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes RBBP4 / RbAp48
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application FACS, ICC/IF, IHC-Fr, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name RBBP4 / RbAp48
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 395-425 of Human RbAp48 (EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
Conjugation Un-conjugated
Alternate Names Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48; Chromatin assembly factor I p48 subunit; Nucleosome-remodeling factor subunit RBAP48; RBBP-4; NURF55; lin-53; CAF-I p48; CAF-I 48 kDa subunit; Chromatin assembly factor 1 subunit C; CAF-1 subunit C; RBAP48; Histone-binding protein RBBP4

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-Fr1:200 - 1:1000
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 54 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 19646 Mouse RBBP4

GeneID: 5928 Human RBBP4

Swiss-port # Q09028 Human Histone-binding protein RBBP4

Swiss-port # Q60972 Mouse Histone-binding protein RBBP4

Gene Symbol RBBP4
Gene Full Name retinoblastoma binding protein 4
Background This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
Function Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 48 kDa