ARG41691

anti-RBMS1 antibody

anti-RBMS1 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes RBMS1
Tested Reactivity Hu
Predict Reactivity Hu, Ms, Rat, Cow, Dog, Goat, Gpig, Hrs, Rb
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name RBMS1
Antigen Species Human
Immunogen Synthetic peptide around the C-terminal region of Human RBMS1. (within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ)
Conjugation Un-conjugated
Alternate Names HCC-4; SCR2; YC1; RNA-binding motif, single-stranded-interacting protein 1; C2orf12; Single-stranded DNA-binding protein MSSP-1; MSSP-1; MSSP; MSSP-2; MSSP-3; Suppressor of CDC2 with RNA-binding motif 2

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 100%; Goat: 93%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
WB2 - 4 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Jurkat
Observed Size ~ 47 kDa

Properties

Form Liquid
Purification Purification with Protein A.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 5937 Human RBMS1

Swiss-port # P29558 Human RNA-binding motif, single-stranded-interacting protein 1

Gene Symbol RBMS1
Gene Full Name RNA binding motif, single stranded interacting protein 1
Background This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq, Feb 2009]
Function Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 45 kDa