ARG59204

anti-Regucalcin antibody

anti-Regucalcin antibody for IHC-Formalin-fixed paraffin-embedded sections and Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes Regucalcin
Tested Reactivity Ms, Rat
Tested Application IHC-P
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Regucalcin
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human Regucalcin. (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD)
Conjugation Un-conjugated
Alternate Names EC 3.1.1.17; Senescence marker protein 30; Gluconolactonase; Regucalcin; HEL-S-41; SMP-30; SMP30; RC; GNL

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 19733 Mouse RGN

GeneID: 25106 Rat RGN

Swiss-port # Q03336 Rat Regucalcin

Swiss-port # Q64374 Mouse Regucalcin

Gene Symbol RGN
Gene Full Name regucalcin
Background The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Function Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities (By similarity). [UniProt]
Cellular Localization Cytoplasm. [UniProt]
Calculated MW 33 kDa